PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT11710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 779aa    MW: 84285 Da    PI: 4.2613
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT11710genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.41.4e-12182223346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE +ll++a + +Gg+ W+ Ia+++  ++t  qc +++++
         EMT11710 182 SWTDEETLLLLEALEIFGGK-WTEIAEHVA-TKTKTQCMLHFLQ 223
                      7*******************.*********.**********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509348.986153IPR007526SWIRM domain
PROSITE profilePS501359.789120166IPR000433Zinc finger, ZZ-type
SMARTSM002912.1E-8120164IPR000433Zinc finger, ZZ-type
SuperFamilySSF578502.35E-11122161No hitNo description
PfamPF005694.4E-8123159IPR000433Zinc finger, ZZ-type
CDDcd023363.80E-20124168No hitNo description
PROSITE patternPS013570126152IPR000433Zinc finger, ZZ-type
PROSITE profilePS5129321.06178229IPR017884SANT domain
SMARTSM007172.8E-13179227IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-13179232IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-9180222IPR009057Homeodomain-like
PfamPF002496.5E-12182224IPR001005SANT/Myb domain
CDDcd001670.00271200224No hitNo description
PfamPF164958.5E-21666744IPR032451SMARCC, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 779 aa     Download sequence    Send to blast
MADLDNCCNP LQLEPKDLAE LSVGEVDARQ EVFDFLDHWG LINFHPFPPA GLEESKPEES  60
QSDSRNEEKA SLIEKLFKFE PVQSYMIPLP NKGEGEIPVP LPTLLPDPVL VEDVIAAAEP  120
SVEYHCNSCS VDCSGKRYHC RTQADFDLCS NCYNEEKFDG GMSKTDFILM DSTEVSGARG  180
TSWTDEETLL LLEALEIFGG KWTEIAEHVA TKTKTQCMLH FLQMQIEDRF HDGDDIHQNI  240
HESTEQALVE KGTPEVPEKM ETEEKVEGKD TKDEKPSEKT EGNHAEEKTE EGSVVENKDA  300
KNSGGADSVT TPNVDEPKPS SDTDLAKENS VNLDTSEKNA PDDAIVISGE NASNDAIDIL  360
KSAFEAVGNF PGHEGSFADA GNPVMALAAF LAGLVEDDNA TTSCRSSLKA ISEDSPALQL  420
ASRHCYILED PPSDLKDIFV TVSNTNKDED QAKGEDQAKG EDMVIDSTGT EKKDINVKEE  480
NTVSVEKQNS PSISPKDHKE SDTKNVSCDD EAPTVEPKSN KAKETDDPIP LVDKGASNDT  540
KVPSSSTKDS VAPENNANGC GLSASQEVVA GSTTCATNPE LLKDKPSSEV EPDDDSSSQG  600
KIELNKTEDA VAAPTAIQED EKTHTLGNGK LEEPNSAENV PADGEMVSRV TAEHNDSLTT  660
LKRAAATAVS AAAAKAKLLA EQEEDQIRRL AALVVEKLLQ KTEAKMSLFA DVEHVALRTR  720
EYTEKTRKKL LMERNAIIAA RMGALPSRPN QQGAAGNRLP PGYGAPAVRP PNAMPRPSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3628980.0AK362898.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2010P22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230701.10.0PREDICTED: SWI/SNF complex subunit SWI3D isoform X1
TrEMBLM8BDG70.0M8BDG7_AEGTA; SWI/SNF complex subunit SWI3D
STRINGMLOC_60197.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45421214